Domains in network 18.232.0.0/14

We found 29,485 domain names pointing to IP addresses in this network. The first 1,000 are displayed.

Get the full report >>



18.232.0.21:
clubstore.pe
  
18.232.0.22:
medlinediscovery.com
  
18.232.0.72:
boldcompas.com
boldcompass.agency
boldcompass.co
boldcompass.com
boldcompass.net
boldcompass.org
boldcompass.us
boldcompassagency.com
sometechie.com
  
18.232.0.93:
frankenmuth.org
  
18.232.0.166:
baach.com
  
18.232.0.170:
johnlong.us
  
18.232.0.191:
capoxysport.com
capoxystore.com
  
18.232.2.22:
softcom.ng
  
18.232.2.93:
nccassady.com
  
18.232.2.193:
tier0.ai
tierdotnine.com
tierpoint9.com
tierpointnine.com
  
18.232.2.216:
canplast.net
  
18.232.3.187:
streamdynamics.net
  
18.232.3.213:
codeanddecode.net
  
18.232.3.224:
logistimatics.com
  
18.232.3.233:
taruhapponen.com
  
18.232.3.249:
devicehost.biz
devicehost.com
devicehost.net
devicehost.us
  
18.232.4.36:
misc-print.com
  
18.232.4.49:
fcipros.com
foodpros.com
foodpros.net
  
18.232.4.79:
omeon.com
  
18.232.4.108:
reboundloan.com
  
18.232.4.162:
metribook.com
metribookeat.com
metribookmart.com
verdiera.com
  
18.232.4.171:
alphagraphicsdigital.com
cpsreach.com
  
18.232.4.180:
kinnective.com
  
18.232.4.219:
smallbizstar.com
  
18.232.4.234:
helmets2hardhats.com
helmets2hardhats.net
helmets2hardhats.org
helmetstohardhats.com
helmetstohardhats.net
helmetstohardhats.org
  
18.232.4.237:
etcarte.ca
  
18.232.4.241:
bonfirepizza.com
  
18.232.5.57:
mentormate.com
  
18.232.5.80:
personalloansreviews.com
rebarint.com
  
18.232.5.122:
meprosacperu.com
  
18.232.5.153:
justgotartdesigns.com
  
18.232.5.156:
t21.mx
  
18.232.6.50:
payumodul.com
  
18.232.6.69:
americanstandardshowers.com
  
18.232.6.152:
meriworkshop.com
  
18.232.6.155:
bluestoneapts.com
bluestoneliving.com
broadwayvillageliving.com
burkartapartmentliving.com
burkartcrossing.com
burkartcrossingapartmentliving.com
burkartcrossingliving.com
burkartliving.com
devonshire-apts.com
devonshireapartmentliving.com
intechpark.com
lauthcommunities.com
lauthcommunities.net
lauthgroup.com
lauthproperty.com
lauthpropertygroup.com
legacypark-apartments.com
legacypark-apts.net
legacyparkapartmentliving.com
liveatburkartcrossing.com
palomarviewapartmentliving.com
palomarviewapartments.com
  
18.232.6.171:
anands.tech
  
18.232.6.187:
english-architects.com
erhawthorne.com
ffllp.com
hawthorneglobal.com
hvllc.com
monroevos.com
nabis.org
theopensourceams.net
  
18.232.7.19:
openagriculturejournal.com
  
18.232.7.80:
chemicalist.com
  
18.232.7.108:
construlightsteel.com.br
consultoryouhub.com.br
mistermaskoto.com
upsellexperts.com
  
18.232.7.155:
chemicalrfp.com
communicationbids.com
electricalrfp.com
electronicsrfp.com
entertainmentrfp.com
hardwarebids.com
hvacbidsandrfps.com
officeequipmentrfp.com
scientificandlaboratorybids.com
transportationbids.com
  
18.232.7.181:
100barrow.com
10provost.com
1110parkave.com
121e22nd.com
1400hudson.com
1425hudson.com
400pas.com
55west17th.com
575south.com
77charlton.com
91leonard.com
builtforyousalesevent.com
coastaloaksatnocatee.com
franklinstationbytoll.com
hampdenrow.com
hasentree.com
huntingdonplace.com
julingtonlakes.com
jupitercountryclub.com
liseter.com
liveatazurenaples.com
liveatlakeshore.com
liveatparklandgcc.com
livethriveresidential.com
loudoun-valley.com
maxwellplace.com
northhobokenparking.com
pierhouseny.com
regencyatmonroe.com
regencyatpalisades.com
regencyatprospect.com
rivingtonbytollbrothers.com
royalpalmpolo.com
thesuttonnyc.com
tollbrotherscityliving.com
tollbrothersflorida.com
valleyandpark.com
  
18.232.7.197:
drivingdirectionshome.org
ezdrivingdirections.org
  
18.232.8.76:
thanosbot.com
  
18.232.8.87:
m8trix5app.com
  
18.232.8.91:
textilespanamericanos.com
  
18.232.8.106:
geoff.beer
  
18.232.8.180:
levlpay.com
  
18.232.8.244:
applywithjeffz.com
mlservices.com
refertrustone.com
trustone.org
trustonefoundation.org
  
18.232.8.255:
halfmoonproject.com
  
18.232.9.89:
vaultboyserver.win
  
18.232.9.93:
alpdemo.com
  
18.232.9.162:
xuxindeng.com
  
18.232.9.173:
eld-pro.com
mapanythingeld.com
trackoneld.com
truckerpatheldpro.com
vexxareld.com
  
18.232.10.68:
avastrip.com
  
18.232.10.95:
agtek.com
  
18.232.10.97:
afterhoursamylawrence.com
b96.com
baconevent.com
baskinandphelps.com
bullandfox.com
calconcerts.com
camelcountry1079.com
cbssportsradio1140.com
cbssportsradio1270.com
cbssportsradio1300.com
cbssportsradio650.com
cbssportsradio910.com
countryfestchristmas.com
desertlanternfestival.com
entercom-wb.com
entercomdigital.com
entercomportland.com
entercomprivacy.com
entercomradiopaynow.com
entercomrochester.com
entercomsacramento.com
entercomseattle.com
frightguidemilwaukee.com
getmyperks.com
hyundaiholidayseries.com
imlistening.org
jblalmostacoustic.com
junkstv.com
kansascityfirst.com
kansascityfirsts.com
karsonandkennedy.com
kcbsam.com
kcbsradio.com
kdkaradio.com
kearth101.com
kfrog.com
keyn.com
kgon.com
kidtopiaaz.com
kiss985.com
kluc.com
kmlecountry1079.com
kluv.com
kmbz.com
knx1070.com
krld.com
ks1075.com
ksfm.com
ktk985.com
kxnt.com
lagrande1075.com
lettersfromhomespringfield.com
litemiami.com
magic1019.com
magic1067.com
magic989.com
majic.com
max1023.com
mikeson.com
mix1051.com
mix1051fm.com
mix1065.net
mix1065baltimore.com
mix965houston.com
my1025christmas.com
new1027.com
notsosilentnightsd.com
now963.com
q94radio.com
rocfestivaloflights.com
rochesterfestivaloflights.com
rockofthe80s.net
roqofthe80s.com
roqofthe80s.net
sandiegoroyals.com
seattlewolf.com
shredtheslopes.com
smartreachdigital.com
southfloridahighschoolsports.com
springfieldcountry.com
starsandstrings.com
stationstreetsipandsavor.com
texasrodeonetwork.com
thefansandiego.com
thedrivebirthday.com
theriseguys.com
topshelforlando.com
unleashyourpride.com
upstatechristmas.com
upstatecraftbeerpassport.com
upstategolfcard.com
vailbourbonandbaconfest.com
waaf.com
watch670thescore.com
watchmaggieandmoose.com
watchmandb.com
watchmandm.com
watchmb.com
watchmooseandmaggie.com
winperfectlook.com
wpgctv.com
yankeehomemilitarymakeover.com
  
18.232.10.156:
premierdefenseconsultant.com
  
18.232.10.186:
serviceamerican.com
  
18.232.11.96:
usmarttech.com
  
18.232.11.150:
alliedwastedalycity.com
  
18.232.11.155:
mindbliss.com
  
18.232.11.168:
fx-hedge.com
  
18.232.11.208:
collegiate.com
merriam-websterscollegiate.com
merriamwebstercollegiate.com
merriamwebsterscollegiate.com
  
18.232.11.218:
atvmaine.org
barkbros.com
barrelsdirect.com
blazebangor.com
brandongoding.com
brandongoding.tech
brightworkdental.com
bucksnakedbbq.com
cmctechgroup.com
coast2coastextracts.com
cooperpavingllc.com
crossfit321.com
dorsoandson.com
dpdesigndp.com
duramagbodies.com
durhamfields.com
ebmetal.us
ejpracing.com
f3mfg.com
finbackbarharbor.com
finixbrewing.com
funkybowbeercompany.com
grassmonkeycc.com
grilljam.com
grilljamdesign.com
harpswellcoastalacademy.org
hemondsmx.com
johnsonhall.org
jwtfmx.com
kgrantdesign.com
kidscrookedhouse.com
kindand.co
lewistonauburnapartments.com
lifestylerae.fit
liveandworkinmaine.com
liveworkmaine.com
loveof.beer
magnummfginc.com
magnumtruckracks.com
mainebeancounters.com
mainemotocross.com
mesfoundation.org
missiontrailers.com
mobility-tech.com
mx207.com
mxpicks.com
napf.com
patracompany-hosting.com
patracompany.com
patsmachias.com
pepclassiccars.com
picarazzi.com
prattandsonsbuilders.com
radio9wcme.com
radiomidcoast.com
radiomidcoastwcme.com
registremblay.com
riverdrive.co
rmbeaumontcorp.com
rockharborbrewing.com
scarletbegoniasmaine.com
stanleysewing.com
starsales.com
talesandales.com
teamppf.com
theblossomcollective.com
theghostsofjeju.net
themainebrewguy.com
tjminc.com
urentit.com
villagecleaningservices.com
vtug.com
vurbmoto.com
  
18.232.11.242:
roostrentersinsurance.com
  
18.232.12.11:
icfgroup.com
icfsource.com
unikavaev.com
  
18.232.12.40:
hurricane.golf
  
18.232.12.161:
ecscorrosion.com
  
18.232.12.222:
beeta.xyz
  
18.232.13.52:
videoamp.blog
  
18.232.13.57:
codyyates.com
  
18.232.13.133:
brokerdispute.com
  
18.232.13.188:
justdancenow.com
  
18.232.13.206:
horseillustrated.com
  
18.232.13.217:
aflacorretora.com.br
alfatransportes.com.br
  
18.232.14.17:
davinci.edu.co
  
18.232.14.36:
climbtechnologies.com
  
18.232.15.62:
bgcgg.org
  
18.232.15.69:
eligis.com.br
  
18.232.15.97:
productoskairos.com
  
18.232.15.212:
bestofketo4beginners.com
feistywomenandmen.com
  
18.232.15.238:
study-abc.xyz
  
18.232.16.79:
aeeteacher.org
openenglishprograms.org
  
18.232.16.93:
wsifusion.com
  
18.232.16.138:
hydrow.com
  
18.232.16.155:
patmos.edu.pe
ucadventista.org
  
18.232.16.225:
ebens.net
heiko-ebens.com
  
18.232.17.31:
evdekipazar.net
  
18.232.17.116:
pvoxx.com
  
18.232.18.63:
spconrad.com
  
18.232.18.113:
isshelegal.com
  
18.232.18.161:
installadvancedheavilyfreeware.icu
installcurrentheavilyfreeware.icu
installdevelopedheavilyfreeware.icu
installfreegreatlyfreeware.icu
installheavilydevelopedfreeware.icu
installheavilyprogressivefreeware.icu
installheavilyrefinedfreeware.icu
installheavilyrenewedfreeware.icu
installheavilysophisticatedfreeware.icu
installlatestheavilyfreeware.icu
installnewestheavilyfreeware.icu
installoriginalheavilyfreeware.icu
installprogressiveheavilyfreeware.icu
installquickgreatlyfreeware.icu
installrecentheavilyfreeware.icu
installrefinedheavilyfreeware.icu
installrenewedheavilyfreeware.icu
installsophisticatedheavilyfreeware.icu
installstronggreatlyfreeware.icu
installswiftgreatlyfreeware.icu
updateadvancedgreatlyfreeware.icu
updateadvancedheavilyfreeware.icu
updatecompletelydevelopedfreeware.icu
updatecompletelyfreefreeware.icu
updatecompletelynewestfreeware.icu
updatecompletelyoriginalfreeware.icu
updatecompletelyprecisefreeware.icu
updatecompletelyprogressivefreeware.icu
updatecompletelyquickfreeware.icu
updatecompletelyrefinedfreeware.icu
updatecompletelyrenewedfreeware.icu
updatecompletelysophisticatedfreeware.icu
updatecompletelyspeedyfreeware.icu
updatecompletelystrongfreeware.icu
updatecompletelyswiftfreeware.icu
updatecurrentgreatlyfreeware.icu
updatecurrentheavilyfreeware.icu
updatedevelopedcompletelyfreeware.icu
updatedevelopedgreatlyfreeware.icu
updatedevelopedheavilyfreeware.icu
updatefreecompletelyfreeware.icu
updatefreegreatlyfreeware.icu
updategreatlyadvancedfreeware.icu
updategreatlycurrentfreeware.icu
updategreatlydevelopedfreeware.icu
updategreatlyfreefreeware.icu
updategreatlylatestfreeware.icu
updategreatlynewestfreeware.icu
updategreatlyoriginalfreeware.icu
updategreatlyprecisefreeware.icu
updategreatlyprogressivefreeware.icu
updategreatlyquickfreeware.icu
updategreatlyrecentfreeware.icu
updategreatlyrefinedfreeware.icu
updategreatlyrenewedfreeware.icu
updategreatlysophisticatedfreeware.icu
updategreatlyspeedyfreeware.icu
updategreatlystrongfreeware.icu
updategreatlyswiftfreeware.icu
updateheavilyadvancedfreeware.icu
updateheavilycurrentfreeware.icu
updateheavilydevelopedfreeware.icu
updateheavilylatestfreeware.icu
updateheavilynewestfreeware.icu
updateheavilyprecisefreeware.icu
updateheavilyprogressivefreeware.icu
updateheavilyrecentfreeware.icu
updateheavilyrefinedfreeware.icu
updateheavilyrenewedfreeware.icu
updateheavilysophisticatedfreeware.icu
updateheavilyspeedyfreeware.icu
updatelatestgreatlyfreeware.icu
updatelatestheavilyfreeware.icu
updatenewestcompletelyfreeware.icu
updatenewestgreatlyfreeware.icu
updatenewestheavilyfreeware.icu
updateoriginalcompletelyfreeware.icu
updateoriginalgreatlyfreeware.icu
updateoriginalheavilyfreeware.icu
updateprecisecompletelyfreeware.icu
updateprecisegreatlyfreeware.icu
updatepreciseheavilyfreeware.icu
updateprogressivecompletelyfreeware.icu
updateprogressivegreatlyfreeware.icu
updateprogressiveheavilyfreeware.icu
updatequickcompletelyfreeware.icu
updatequickgreatlyfreeware.icu
updaterecentgreatlyfreeware.icu
updaterecentheavilyfreeware.icu
updaterefinedcompletelyfreeware.icu
updaterefinedgreatlyfreeware.icu
updaterefinedheavilyfreeware.icu
updaterenewedcompletelyfreeware.icu
updaterenewedgreatlyfreeware.icu
updaterenewedheavilyfreeware.icu
updatesophisticatedcompletelyfreeware.icu
updatesophisticatedgreatlyfreeware.icu
updatesophisticatedheavilyfreeware.icu
updatespeedycompletelyfreeware.icu
updatespeedygreatlyfreeware.icu
updatestrongcompletelyfreeware.icu
updatestronggreatlyfreeware.icu
updateswiftcompletelyfreeware.icu
updateswiftgreatlyfreeware.icu
  
18.232.18.205:
jmypass.com
  
18.232.18.221:
nebraskapools.com
  
18.232.19.9:
apponboard.com
  
18.232.19.69:
advisoryteam.org
digitalinsiderscommunity.com
essenceinsiders.com
fashionadvisors.com
hddiydepot.com
influ-gente.com
insiderscouncil.com
messengerkidscommunity.com
mymediachat.com
myinvestorvoice.com
revolution55.com
shrminsights.com
verabradleyinsiders.com
xfinityfrontline.com
  
18.232.19.71:
acexplatform.com
  
18.232.19.177:
15cams.adult
meetcammodels.porn
  
18.232.20.211:
bankingbr.com.br
  
18.232.20.253:
mintshipping.com
  
18.232.21.17:
emeraldtrophy.com
  
18.232.21.28:
geotix.io
  
18.232.21.128:
loculars.com
  
18.232.21.133:
sfe.io
sparkfun.com
  
18.232.21.176:
benchtools.us
  
18.232.21.179:
automantenimenthrd.com
  
18.232.21.193:
tcs-development.com
tcs-development.info
tcs-development.net
tcs-development.org
  
18.232.21.198:
plazanetwork.biz
plazanetwork.com
plazanetwork.es
plazanetwork.org
plazanetwork.ws
  
18.232.21.209:
heritagecateringar.com
  
18.232.21.236:
mdcomputers.in
  
18.232.22.56:
glg.link
  
18.232.22.208:
sip3.io
  
18.232.22.236:
clubdesociospepsico.com.mx
  
18.232.22.237:
toschparts.com
  
18.232.23.16:
betsorpe.com
lineagis.org
tutiendape.com
  
18.232.23.82:
conexao2021.com.br
  
18.232.23.85:
findcaraccidentdoctors.com
  
18.232.23.149:
ivvgaming.com
  
18.232.23.196:
thespoils.luxury
  
18.232.23.198:
kuisbi.com
  
18.232.23.212:
restauranttablelinens.com
  
18.232.24.13:
adawebguard.com
  
18.232.24.56:
evaluarjobs.com
evaluarjobs.dev
  
18.232.25.13:
crafterfaster.com
  
18.232.25.184:
iahpr.space
  
18.232.25.196:
peacemindandbody.com
  
18.232.25.222:
jwimageco.com
  
18.232.25.223:
tigerteamconsulting.com
tigerteamit.com
  
18.232.26.20:
casionewsroom.com
seasidesemperfive.com
seasidesemperfive.org
  
18.232.26.73:
eshop.ec
  
18.232.26.92:
thegreatcoursesplus.com
  
18.232.26.113:
quanta.com.br
quantastore.com.br
  
18.232.26.116:
creavorite.com
  
18.232.26.141:
medicalcloudprofile.dev
webtomed.dev
wtmapis.dev
  
18.232.26.146:
myanmarcesd.org
  
18.232.27.99:
fairmont-ru.com
fairmont-tr.com
fairmont.ae
fairmont.de
fairmont.fr
fairmont.mx
raffles-ae.com
raffles-hotels.de
raffles-tr.com
raffles.es
raffles.fr
raffles.ru
swissotel-hotels.ru
swissotel.ae
swissotel.de
swissotel.es
swissotel.fr
  
18.232.27.139:
gore-tex.co.kr
gore-tex.co.uk
gore-tex.com
gore-tex.com.au
gore-tex.com.hk
gore-tex.com.tw
gore-tex.de
gore-tex.es
gore-tex.fr
gore-tex.it
gore-tex.jp
gore-tex.nl
gore-tex.pl
gore-tex.ru
gore-tex.se
  
18.232.27.155:
bjualumni.live
  
18.232.27.210:
diag.net
  
18.232.27.231:
limeworksllc.com
  
18.232.28.90:
scoti.com.br
  
18.232.28.162:
commutingthecosmos.com
  
18.232.28.167:
searchsaltlake.org
  
18.232.28.185:
jsoundevents.com
  
18.232.28.194:
ipirangafrotista.com.br
  
18.232.28.228:
hillsideinternet.net
rrrautosales.com
  
18.232.28.239:
feedthetown.org
  
18.232.29.25:
turtletiming.com
  
18.232.29.80:
hamstoo.com
  
18.232.29.96:
wciconsulting.com
  
18.232.29.120:
hcsweb.de
  
18.232.29.177:
totalinsightconsulting.com
  
18.232.30.1:
webanalyticsmarketing.com
  
18.232.30.31:
butterlondon.com
  
18.232.30.114:
fin-enduro.com
kalkku.fi
  
18.232.30.139:
vulnadvisor.com
  
18.232.30.178:
circlessys.com
diseo.me
field90sys.com
heiqrows.ch
heiqrows.com
  
18.232.30.219:
autoaudience.com
autoaudience.net
autoaudiencenetwork.com
automotiveaudience.com
automotiveaudiencenetwork.com
localdealercontent.com
speedshiftmedia.com
speedshiftmedia.net
  
18.232.30.221:
xinguedu.press
  
18.232.30.223:
chemexcalculator.com
  
18.232.30.237:
rollingstrong.com
  
18.232.31.73:
recordlink.one
  
18.232.31.197:
grupoenelcolombia.com
  
18.232.31.212:
whiskeyferment.com
whoseexuberant.com
widespreadcorporal.com
wilddiabetic.com
winbenefactor.com
wishenclave.com
witdogged.com
womananemia.com
worstexhilarate.com
  
18.232.32.31:
ebradi.com.br
  
18.232.32.43:
lizziebydesign.com
  
18.232.33.26:
smartplanetsoftware.com
  
18.232.33.32:
dalmiaresorts.com
  
18.232.33.44:
apolloprogram.io
  
18.232.33.135:
beldonmailer.com
  
18.232.33.165:
thegreenapparel.com
  
18.232.33.194:
thepmd.com
  
18.232.33.205:
kscvcvi.com
myatxreports.com
  
18.232.33.208:
nutrashepherd.com
  
18.232.34.50:
glesec.com
glesec.net
  
18.232.34.75:
digapit.com
nosetowind.com
optforless.com
theburpee.com
  
18.232.34.87:
mhctetramer.com
tetramers.net
  
18.232.34.91:
ulam-lang.org
  
18.232.34.99:
callintelligencesoftware.com
  
18.232.34.104:
failover.com.bo
  
18.232.34.129:
13dev.us
  
18.232.35.86:
reactive-commerce.app
  
18.232.35.209:
simplechurchwebsites.co
  
18.232.35.214:
innerinstigator.com
  
18.232.36.1:
catcherinthetry.com
  
18.232.36.6:
geopost.com.br
ignisplanning.com
  
18.232.36.16:
graphafi.io
  
18.232.36.23:
antengraphics.com
  
18.232.36.105:
civilsociety4health.org
  
18.232.36.116:
411xml.com
findnewleads.com
ndis.us
  
18.232.36.174:
exceptionaire.co
exceptionaire.com
mavinkurveassociates.com
thedivorcelawfirm.in
waterforlife.org.in
  
18.232.36.228:
eercast.com
  
18.232.36.236:
privateoctopus.com
  
18.232.37.62:
17.edu.mx
evgenbavcar.com
evgenbavcar.org
  
18.232.37.80:
bahamarcms.com
  
18.232.37.120:
1m2.com.br
  
18.232.37.227:
discoverideas.co.in
  
18.232.37.237:
keeeb-staging-bcg.com
  
18.232.38.17:
wisengine.org
  
18.232.38.113:
cocowao.co
  
18.232.38.143:
apptrainer.com.br
  
18.232.38.234:
paycab.app
  
18.232.39.25:
kpwood.com
thelinguist.com
  
18.232.39.125:
themcssolution.com
  
18.232.39.168:
cbwsfcu.org
  
18.232.40.43:
melhorrastreio.com.br
  
18.232.40.70:
landuniform.com
  
18.232.41.11:
bleedingcontrol.org
  
18.232.41.107:
newtonvirtual.com
  
18.232.41.138:
dietgene.com
  
18.232.41.255:
fareabt.com
  
18.232.42.19:
datasales.info
datasales.io
  
18.232.42.31:
eire.link
  
18.232.42.122:
science-h.com
  
18.232.42.154:
ohioslargestplayground.com
  
18.232.42.161:
pakfactory.com
  
18.232.42.242:
interbibler.com
  
18.232.42.243:
agreenduval.com
  
18.232.43.97:
servicetrackingsystems.com
servicetrackingsystems.net
  
18.232.43.184:
acupunturacaba.com
athanconsulting.com
nodet.co
notiluxe.fr
rusegur.com
wikiperma.org
  
18.232.44.24:
wcst-t4ng-onramp-dpcg.com
  
18.232.44.130:
kirakosianlaw.com
  
18.232.44.158:
sv3.us
  
18.232.44.230:
acloudpage.com
  
18.232.44.231:
healthecareers.com
  
18.232.45.35:
forwyrd.ventures
  
18.232.45.92:
rvdocs.io
  
18.232.45.164:
internetincomeexplained.com
  
18.232.45.166:
dream11.ae
dream11.in
  
18.232.45.183:
digitalhire.com
  
18.232.46.39:
drgadaptive.com
integratedhealthdata.com
  
18.232.46.160:
portaldeltaomega.com.br
  
18.232.46.166:
delightfullyodd.art
  
18.232.46.214:
cooprofesionales.com.pa
  
18.232.46.249:
missionminded.church
  
18.232.47.2:
zouyixr.vip
  
18.232.47.126:
beenthere.mba
  
18.232.47.134:
charlestonvaca.com
  
18.232.47.144:
hitechsaidigital.com
  
18.232.47.177:
homefeedrealty.com
  
18.232.48.43:
complaiance.com
complaiance.de
digitalquiz.de
easyup.app
elytics.net
huxleymortgageservices.co.uk
leadchirp.io
nikolausfischer.com
stadtfrust.com
stadtfrust.de
trialy.io
  
18.232.48.152:
ccaq2020.com
  
18.232.48.162:
talktwo.com
  
18.232.48.176:
verbose.me
  
18.232.48.219:
gaussconnect.com
  
18.232.49.94:
q-garage.org
  
18.232.49.136:
mdaconference.com
mdaconference.org
meetthestrains.com
  
18.232.50.66:
economyinsensitive.com
enterpriselavish.com
entirelyhypocrite.com
executelegislature.com
explanationlayoff.com
farmjuggle.com
fightimpeach.com
garageitalic.com
  
18.232.50.93:
jackagood.com
  
18.232.51.117:
accordinglylengthy.com
actionimmunity.com
alcoholimpotent.com
amazingirresistible.com
attractintestine.com
  
18.232.51.140:
meyerssoftware.com
  
18.232.51.176:
rorygallagher.com
  
18.232.52.17:
segurodeviajemundial.net
  
18.232.52.137:
newsfix.ca
  
18.232.52.175:
boydcreative.net
expressivelabs.com
financechoices.co.uk
isabellawrites.com
thebestnursingschools.net
theoutreachers.com
zestymarketing.co.uk
  
18.232.52.216:
greeklifeevents.com
  
18.232.53.69:
dandomitravels.com
  
18.232.53.146:
15as.com
at4.am
blueteq.io
bvr.sh
caudill.co
dlrg.co
dmsn.gr
etc.ai
gregi.am
hawks.media
jdhr.tl
lgnmrktng.com
maxtemk.in
mbk.mx
nim.bz
p3d-share.xyz
pi.cx
pickpea.ch
screen.ac
seth.team
sharky.biz
ssh.fm
weave.nz
  
18.232.54.28:
dpmeducacao.com.br
  
18.232.54.109:
containtrudge.life
consultationaria.life
conveywary.life
correspondvindicate.life
  
18.232.55.112:
courtesyinvestigator.com
  
18.232.55.139:
naildependency.life
nationcommissioner.life
  
18.232.55.189:
synapticecho.com
  
18.232.56.32:
sufferinghumidity.net
wirelessindecent.com
  
18.232.56.104:
calmnesscurly.life
cancollision.life
coffeecrutch.life
commitcrust.life
cosmoschuckle.life
  
18.232.56.164:
withdrawcoincide.life
  
18.232.56.226:
transactiondashboard.com
  
18.232.57.67:
mail-quotes.club
  
18.232.57.238:
coast2coastautotransport.com
  
18.232.58.16:
deadlydeals.net
  
18.232.58.21:
matterofbetterhealthin.com
  
18.232.58.29:
campusutb.com
  
18.232.58.56:
amirian.com
  
18.232.60.71:
wakefieldkidsyogatraining.com
  
18.232.60.127:
capefearmetalworks.com
uglysmokers.com
  
18.232.61.24:
pracsheets.com
  
18.232.61.83:
impeictor.com
inapeas.com
rhilm.com
  
18.232.61.160:
senaldeportes.tv
  
18.232.61.200:
laserbuilds.com
  
18.232.61.227:
appliedtraction.com
belt-heater.com
eliminatefreezing.com
eliminatesfreezing.com
hi-jacked.com
point-heater.com
roninonline.co.uk
  
18.232.61.254:
unclebeccs.com
  
18.232.62.24:
famclans.com
  
18.232.62.28:
bananasmoothiesnearme.com
  
18.232.63.88:
openlaudo.org
  
18.232.64.2:
envydog.com
  
18.232.64.40:
csdevsafe.org
  
18.232.64.47:
blessingsomeone.org
  
18.232.64.118:
al17239.systems
  
18.232.64.206:
m10institute.com
  
18.232.65.235:
lifewithmd.com
  
18.232.66.126:
comebackhome.org
  
18.232.66.151:
lab-demos.com
  
18.232.67.1:
hillfarm.biz
  
18.232.67.55:
meditationgroupatwilburn.com
  
18.232.67.253:
insideyerevan.com
  
18.232.68.234:
lmrc360.com
  
18.232.69.38:
flickstree.com
  
18.232.69.54:
celos.io
celosmfg.com
  
18.232.70.49:
mostefficientfitness.com
  
18.232.70.103:
85supply.com
  
18.232.71.8:
yogachinosmeetup.com
  
18.232.71.37:
washawayppe.com
  
18.232.71.72:
ikarus.pe
  
18.232.71.139:
ganar-mucho-dinero.com
tuhogarcondinero.com
  
18.232.72.8:
thomastravel.eu
  
18.232.73.1:
chieuleephotography.com
  
18.232.73.186:
fbacloverdale.org
vbcwhiteville.org
  
18.232.74.170:
wiredwestfiber.com
wiredwestfiber.net
  
18.232.75.110:
noopico.com
  
18.232.76.9:
ltazmin.com
  
18.232.76.83:
al17251.tech
  
18.232.76.161:
decacornapps.com
  
18.232.76.240:
nuxab.com
rentamosdepa.com
  
18.232.77.23:
senalrockcolombia.gov.co
  
18.232.77.119:
sigquestdev.tk
  
18.232.77.210:
reddyidly.in
  
18.232.78.27:
theplasticsource.com
  
18.232.78.61:
ipsapi.com
  
18.232.79.81:
covidtesting.app
  
18.232.80.97:
evergent.org
  
18.232.80.184:
joyandjubilance.com
  
18.232.80.191:
edrop.co
goladiespro.net
ignite10.com
ignitex.com.ng
martintaxi.com
pulluptechnologies.net
  
18.232.80.234:
al17389.tech
  
18.232.81.71:
gabe1.com
  
18.232.81.88:
kapitoe.com
  
18.232.81.113:
seemayzing.com
  
18.232.81.114:
chilenosenaustralia.cl
  
18.232.81.140:
audreyzhao.com
  
18.232.81.176:
gio.care
  
18.232.81.247:
nslmail.com
  
18.232.83.86:
realguide.org
  
18.232.83.234:
helperdesk.net
  
18.232.84.44:
gbekos.com
  
18.232.84.170:
legaltracs.com
  
18.232.84.223:
cfgtampa.com
  
18.232.84.227:
cachapa.club
  
18.232.85.48:
amishfurnitureconnection.com
amishfurnitureconnections.com
authenticallyamish.com
dancingbearsgifts.com
dancingbearshomeandgift.com
fairfaxhottubs.com
hottubsandpooltablesoutlet.com
leonardsafety.com
m-testco.com
mbxit.com
newlinebathroom.com
realwoodamishfurniture.com
saraschneidman.com
swetmansamishfurniture.com
westernbootfinder.com
  
18.232.85.204:
mycanon-europe.com
  
18.232.86.22:
guccilove.com
  
18.232.86.100:
ssi-atx.com
ssi-atx.rocks
  
18.232.86.216:
hthguide.in
  
18.232.87.18:
betterprosperityfactors.com
  
18.232.87.50:
keepmayorwhalen.com
  
18.232.87.90:
ureasywellness.com
  
18.232.88.96:
offerknot.com
  
18.232.88.137:
firewords.in
  
18.232.88.207:
goyng.net
  
18.232.88.227:
andrea-josh.com
  
18.232.88.234:
allmedicalbooks.com
  
18.232.89.2:
thepiouscoin.com
  
18.232.89.14:
chimichangas.gr
dreamestate.gr
funhunbun.com
  
18.232.89.196:
bodystoevolutions.com
  
18.232.90.5:
gerhardvandyk.nom.za
  
18.232.90.90:
rreventures.net
  
18.232.90.147:
bvsecurity.com
bvsecurity.info
bvsecurity.net
  
18.232.91.13:
domumpopuli.com
  
18.232.91.122:
diamondhomeinspectors.com
  
18.232.92.31:
dojopy.com
  
18.232.92.84:
rpslsr.com
  
18.232.92.156:
icomint.com
  
18.232.92.206:
rogova.xyz
  
18.232.93.65:
homeschoolsi.com
  
18.232.94.13:
iqmalls.com
  
18.232.94.75:
carenergen.com
  
18.232.94.237:
ednh.news
  
18.232.94.250:
ssompl.com
  
18.232.95.31:
microturbinetechnologies.com
  
18.232.95.56:
allowgreaterwellness.com
  
18.232.95.92:
unemploymentfiling.org
  
18.232.96.5:
cubita.club
  
18.232.96.60:
luhoskin.com
  
18.232.96.72:
diacoms-online.com
  
18.232.96.141:
pocahontas895.com
  
18.232.97.94:
yogamauistyle.com
  
18.232.97.195:
alphaomegago.com
  
18.232.99.134:
rollingrock.in
  
18.232.99.192:
abelkc.org
bkspropertygroup.com
bruceglennteam.com
fountainco.de
stricklandguitar.com
thefemaleadvisor.com
wrhardwoodfloors.com
  
18.232.100.121:
vivelochannel.com
  
18.232.100.151:
pikespeaknewspapers.com
  
18.232.100.201:
sbhfitnesscenter.com
  
18.232.100.242:
level-finish.com
  
18.232.103.0:
mjloans.net
  
18.232.103.170:
doubledinsurance.com
  
18.232.103.214:
proemdesenvolvimentoweb.com.br
wptech.com.br
  
18.232.104.112:
kahonakahani.com
  
18.232.104.138:
geotrack.co.cr
  
18.232.104.228:
spiralis.com.mx
  
18.232.105.177:
yetgymnasium.net