Domains in network 98.100.0.0/14

We found 2,391 domain names pointing to IP addresses in this network. The first 1,000 are displayed.

Get the full report >>



98.100.7.7:
savagedns.com
  
98.100.7.8:
mustanggirls.us
wigwamenterprises.com
  
98.100.9.2:
tigerden.com
tigerden.net
tigerden.org
tigerwolf.com
tigerwolf.net
tigerwolf.org
tigerwolfinc.com
wolftimbers.com
wuffy.net
wuffy.org
  
98.100.9.3:
wolfparkkids.com
  
98.100.9.5:
tigermail.net
tigermail.org
  
98.100.10.246:
codergeek.net
  
98.100.11.6:
seansbaby.info
  
98.100.12.165:
isalestrack.com
  
98.100.12.167:
isalespulse.com
  
98.100.14.42:
hubbardtownshippolice.org
  
98.100.14.98:
midwestie.com
  
98.100.14.110:
brookemauro.com
helicopterhunter.com
jkmods.com
johnmauro.com
nicolemauro.com
texasworksafe.com
workplaceehs.com
  
98.100.14.249:
appsearchmedia.com
  
98.100.15.52:
paradigmfault.com
  
98.100.17.164:
myonlineit.com
  
98.100.17.170:
revenuecyclemanagementsolutions.com
  
98.100.17.171:
atchisoncountyrecorder.com
gentrycountyrecorder.com
madisoncountyrecorderofdeeds.com
mercercorecorder.com
reynoldscountyrecorder.com
shelbyrecorder.com
waynecountyrecorder.com
  
98.100.17.173:
myonlinedocuments.net
  
98.100.18.45:
affordablesupport.com
bobland.com
  
98.100.18.178:
rsinetworks.com
  
98.100.21.144:
darrylschott.com
  
98.100.24.102:
corryclassof74.com
  
98.100.26.237:
sesecurity.com
  
98.100.29.10:
gooddaymansfield.com
  
98.100.29.16:
rgsmithcompany.com
  
98.100.31.178:
gravattglassandelectric.com
greenvillereynolds.com
mercergop.net
mercerpagop.com
munnellrunfarm.org
station89.org
  
98.100.35.6:
ohiobrewing.net
  
98.100.36.50:
koreannetwork.com
newsbags.com
saneckvpn.com
  
98.100.39.194:
31eaquatics.com
31eorganics.com
bradsmp.com
bradthefnafgamer.com
evilfury.com
i5ys0p.com
keepconnectedlive.com
marchbradness.com
mattcavins.com
snivac.com
threespringsknob.com
  
98.100.41.152:
perkinscomm.com
youngstownmetalfab.com
  
98.100.41.153:
onlineptv.com
  
98.100.42.226:
celuch.us
celuchcreative.com
fzrlaw.com
jrsclassicrestoration.com
jurlawfirm.com
millwoodqualityfurniture.com
yodershomeupholstery.com
yoderssofas.com
  
98.100.42.252:
telecom-tools.com
timetraxessentials.com
  
98.100.44.210:
nal3pl.com
  
98.100.46.117:
promprep.org
  
98.100.47.42:
marketplaceinsightscertifiedreviews.com
  
98.100.47.44:
mpinsights.us
  
98.100.47.219:
bike4sight.org
  
98.100.54.98:
andersonplastics.com
  
98.100.55.28:
lillieeatsandtells.shop
myproductionhouse.com
  
98.100.59.155:
obflow.com
thedevicetracker.com
  
98.100.59.156:
americanbackflowcalibration.com
americanbackflowcertifiers.com
mybackflowtest.com
  
98.100.59.157:
thedevicemanager.com
thesitesurvey.com
  
98.100.59.197:
awardsbyelk.com
  
98.100.59.200:
newportmint.com
  
98.100.59.202:
promosalive.com
  
98.100.59.203:
timsusacatalogue.com
  
98.100.62.204:
backtobasicsmarket.com
palmboxsoftware.com
  
98.100.65.179:
enterprise-advisors.ca
secondfoundation.ca
sfci.ca
  
98.100.65.182:
goerie.us
  
98.100.65.249:
hosevault.com
  
98.100.66.158:
neblueupload.com
  
98.100.66.226:
pipesmokeblog.com
  
98.100.68.2:
extrudexohio.com
  
98.100.71.163:
pdq-clean.com
woodfordco.com
  
98.100.72.250:
akrondispersions.com
  
98.100.75.213:
mydirectroute.com
  
98.100.77.182:
chardonfire.com
  
98.100.82.34:
incredi-puffs.com
incredi-snack.com
incredi-snacks.com
incredipuffs.com
incredisnack.com
incredisnacks.com
munchrights.com
snackfetti.com
snackingforthehealthofit.com
thebetterwaytosnack.com
thesnackbrigade.com
unitedwesnack.com
wyandotpopcornmus.com
wyandotsnacks.com
  
98.100.82.56:
timhortonspop.com
  
98.100.84.10:
perioincorders.com
  
98.100.84.74:
hihpeds.com
  
98.100.87.142:
genoapolice.org
  
98.100.88.50:
voyager60.com
  
98.100.88.120:
ovsurgical.net
  
98.100.88.122:
ovshpath.com
  
98.100.90.169:
wilsoncarenetwork.com
wilsonhospital.com
  
98.100.91.66:
keysourcemedical.com
keysourcemedicalorders.com
  
98.100.91.68:
praxismedinternational.com
praxmed.com
  
98.100.91.69:
keysourceusa.com
  
98.100.91.171:
huddlestons.com
introspectives.us
ironknightcycles.com
  
98.100.92.54:
criggerfarm.com
  
98.100.92.78:
fmg-exhibits.com
infocusreviews.com
kevindcarlson.com
melodyvine.com
sammyelynn.com
  
98.100.93.196:
costrecoverycorp.com
  
98.100.95.44:
thenorki.com
  
98.100.95.130:
frednorthcutt.com
  
98.100.96.34:
mylucity.net
  
98.100.96.146:
thainc.net
  
98.100.96.234:
allstaterenovations.com
  
98.100.98.234:
dreamqr.com
  
98.100.99.86:
agifanproducts.com
calebamundson.com
  
98.100.99.250:
hiremcdkc.com
  
98.100.104.198:
ctckc.net
  
98.100.105.82:
rmxkc.com
specs-inc.com
  
98.100.105.170:
kcpd.org
  
98.100.107.31:
ftjsolutions.com
insurancebyfamilyguard.com
memberprogram.com
trustforeducators.com
  
98.100.107.63:
insurservices.com
  
98.100.107.65:
ftjconnect.com
meuhp.com
  
98.100.107.67:
fslins.com
  
98.100.107.80:
ftj-tpa.com
ftjtpa.com
  
98.100.107.90:
ftjexpress.com
  
98.100.107.103:
fslny.com
ftj.com
ftjcc.com
  
98.100.107.140:
pro-defender.biz
pro-defender.com
pro-defender.net
prodefender.biz
prodefender.com
prodefender.org
  
98.100.107.236:
seemyinsurance.com
  
98.100.108.82:
itswarehouse2.com
  
98.100.109.162:
gladstonekidstri.com
  
98.100.110.58:
disciplingbelievers.com
  
98.100.110.59:
timberlineturf.com
  
98.100.110.61:
summitsmarthome.com
  
98.100.110.62:
lscharacter.org
  
98.100.110.182:
chelseasart.com
cmproductions.org
kchorndeluxe.com
markosa.com
sleepyj.com
  
98.100.112.113:
fcaportal.com
ow2p.com
ow2p.org
r12coach.com
  
98.100.112.130:
tmlf.com
  
98.100.112.190:
mavenconsulting.com
thehulls.com
  
98.100.113.51:
aaoncontrols.com
tacoselect.biz
tacoselect.net
tacoselect.org
  
98.100.113.79:
tacoselect.com
  
98.100.113.122:
misnetworks.net
  
98.100.114.27:
brentcrossgiftcard.co.uk
brentcrossgiftcard.com
bullringgiftcard.co.uk
cabotcircusgiftcard.co.uk
cabotcircusgiftcard.com
centralegiftcard.co.uk
centralegiftcard.com
croydongiftcard.co.uk
croydongiftcard.com
dundrumgiftcard.com
dundrumgiftcard.ie
emltopup.com
getmybalance.com
highcrossgiftcard.co.uk
highcrossgiftcard.com
promotionrewardcard.com
silverburngiftcard.co.uk
silverburngiftcard.com
theoraclegiftcard.co.uk
theoraclegiftcard.com
unionsquaregiftcard.co.uk
unionsquaregiftcard.com
victoriagiftcard.co.uk
victoriagiftcard.com
victoriaquartergiftcard.co.uk
victoriaquartergiftcard.com
westquaygiftcard.co.uk
westquaygiftcard.com
  
98.100.118.152:
leavenworthvs.org
  
98.100.121.203:
pembrokehill.net
  
98.100.123.27:
kbnlab.net
  
98.100.127.124:
luxuryobsessions.jewelry
thingswebuy.jewelry
thingswesell.jewelry
  
98.100.127.125:
800goldkit.jewelry
elitediamondbuyers.jewelry
goldbythegram.jewelry
goldkit.jewelry
  
98.100.127.126:
beyond79.jewelry
outofyourlife.us
recycleplatinum.jewelry
  
98.100.128.170:
lorum1.com
  
98.100.130.3:
cclearsolutions.com
  
98.100.130.109:
mukwonagovillagerun.com
  
98.100.131.162:
lbribiz.com
  
98.100.132.245:
lccwi.com
lovejoycontrols.com
  
98.100.133.86:
vandenbergllc.com
  
98.100.133.210:
farmpartsnet.com
halfassbeef.com
theanythinggroup.org
  
98.100.137.82:
waldoimplement.com
  
98.100.142.20:
mwconnect.net
  
98.100.144.2:
pcsllc.bz
  
98.100.144.201:
getinshapewith.us
getinshapewithus.com
granulation.com
  
98.100.144.202:
wheredidyouseeme.com
  
98.100.146.198:
swansonwiper.com
  
98.100.146.222:
cscasters.com
csccasters.com
  
98.100.147.166:
langkau.org
oshkoshusa.com
  
98.100.149.15:
visonex.net
  
98.100.149.200:
mmspharmacy.com
  
98.100.152.76:
360collaborationtools.com
360data.biz
360data.com
360data.info
360datasystems.com
360logisticsgroup.com
36odata.com
vanhoof.com
wsilogistics.com
wsinc.biz
wsinc.info
wsinc.org
wsirnd.com
wsirnd.net
  
98.100.152.77:
sound-inc.com
  
98.100.152.135:
cocoabeachvacationpackages.com
hbtazdocs.com
tcsplanning.com
zilber.com
zilberfamilyfoundation.com
zilberfamilyfoundation.org
zilberresidentialgroup.com
zrgdev.com
  
98.100.152.166:
jwspeakerecommerce.com
  
98.100.152.226:
krahnconsulting.com
rmc-inc.com
  
98.100.153.114:
borkin.net
  
98.100.154.12:
wi-assessor.com
  
98.100.154.71:
phewholesale-midwest.net
  
98.100.154.210:
diversepa.com
  
98.100.157.178:
margis.org
  
98.100.160.85:
tapconet.com
  
98.100.162.235:
etmalec.net
kwzs.be
  
98.100.165.58:
cetwi.com
  
98.100.166.43:
bethkefamily.com
recordsministry.com
  
98.100.167.109:
peripatetics.net
  
98.100.167.171:
clauerfamily.com
  
98.100.167.181:
timryder.net
  
98.100.168.73:
7sharps.com
arcfile.com
arrowhvacllc.com
athleticfootdoc.com
bitwiz.net
blastfiction.com
bublitzelectric.com
classiccarpetcleaning.net
contractpainting.com
donnarewolinski.com
dustlaw.com
eatingdisordersmilwaukee.com
exclusivahairdesign.com
financialvaluesllc.com
foundationmke.com
foundationproperties.com
heindlfamily.org
hongstkd.com
iguazuarts.com
indgenagencies.com
jacksonpark.us
markhoelscher.net
mkemarketingllc.com
mrasllc.com
mylibertytax.com
partnersinmedicalmissions.org
patswan.com
shcmilwaukeecounty.com
srpennlaw.com
srsc.com
srtf-law.com
stflorian.org
techlabhq.net
techlabhq.us
trinityecosolutions.com
vanrixelmagic.com
vanrixelproductions.com
weddingwi.com
  
98.100.168.76:
beautybarsocial.com
circlewisconsin.com
midwestmarketplace.org
  
98.100.168.80:
techlabhq.com
  
98.100.168.82:
preferredcleaningservice.com
  
98.100.168.83:
balleradance.com
  
98.100.168.84:
afghanpressmusic.com
  
98.100.168.86:
rouflaw.com
  
98.100.168.87:
edersimprovements.com
  
98.100.168.88:
concoursautoworks.com
  
98.100.168.89:
contentcreationcoach.com
  
98.100.168.106:
brewcitybrand.com
  
98.100.170.175:
billbirch.com
  
98.100.171.82:
balanceanimationstudios.com
balancearstudios.com
balanceinteractivestudios.com
balancemotionmediastudios.com
believeanimation.com
brettnooyen.com
dinosaurusexploreus.com
epicsoft.net
rocksinmysocksbook.com
wonderwerkz.com
  
98.100.172.101:
dortsdarts.com
gjersoft.com
runecasting.com
sensible.guru
sensibleevil.com
sensiblefare.com
sensiblefirewall.com
sensiblegurus.info
sensiblerepair.info
zoomingdrone.com
  
98.100.174.71:
freqi.net
  
98.100.179.110:
mbcwebradio.com
  
98.100.180.70:
getprints.com
  
98.100.181.235:
ghdisaster.net
  
98.100.183.44:
al-fuse.com
alfuse.com
c-wep.com
cain-ind.com
cain-industries.com
caineconomizer.com
caineconomizers.com
cainexports.com
cainind.co
cainind.com
cainind.mobi
cainind.net
cainind.org
cainindustries.mobi
cainindustries.net
cainindustries.org
cainindustries.work
cainindustriesinc.com
cainproductions.com
cainrep.com
cainrep.net
cainwindows.com
cainwindows.net
cbwep.com
cbwep.mobi
ciwep.com
cogenerationheat.com
cogenerationretrofit.com
cogenerationsteam.com
exhaust-heat-recovery.com
exhaustheatexchange.com
exhaustheatrecovery.com
exhaustheattransfer.com
furnacemate.com
heatrecoverysteam.com
sigmablip.com
timberhillherd.com
voodoozombie.com
  
98.100.183.184:
rm-rehab.com
  
98.100.185.99:
suggestionbasket.com
  
98.100.186.211:
statebankofnewburg.com
  
98.100.188.109:
flpsgroup.com
  
98.100.188.123:
halo11.com
  
98.100.193.60:
actdrivers.com
attdrivers.com
etidrivers.com
uttdrivers.com
  
98.100.194.206:
stegerheating.com
  
98.100.195.60:
digitalprintapproval.com
  
98.100.195.107:
wildweststudios.org
  
98.100.195.230:
coop18.com
crivello.com
crivello.net
doverholding.com
easterncoastmanagement.com
farwellequitypartners.com
marinegrowthventures.com
marksinvestments.com
nationalmgt.com
titanglobalholdings.com
  
98.100.196.86:
egsoftwaresolutions.com
  
98.100.196.171:
jensenweb.net
  
98.100.197.202:
bridlewoodapts.com
bristolarmsapts.com
fieldstoneestatesliving.com
lakepointterrace.com
lisboncourt.com
liveatthefranklin.com
metapts.com
metropolitanassociates.com
northernbluffs.com
northridge-terrace.com
okgardensapts.com
overlooktownhomes.com
parksidemadison.com
theoverlook.net
weybridgeapartments.com
  
98.100.198.24:
midwestcollegelibrary.com
  
98.100.199.34:
sbtserver.info
  
98.100.199.70:
controlship.com
glowcontrol.com
  
98.100.201.10:
fittingbook.com
hfifluidpowerproducts.com
  
98.100.201.14:
biemeck.com
  
98.100.202.139:
heuerlawoffices.net
  
98.100.203.46:
jwendt.com
  
98.100.204.3:
rotaform.us
  
98.100.204.165:
hildebrandtenterprises.com
  
98.100.204.170:
toothsomerue.com
  
98.100.204.218:
customgrading.com
hauntedwhisper.com
midwestenduro.com
  
98.100.205.10:
cobaltpartnersllc.com
  
98.100.205.226:
confidencepay.com
  
98.100.206.178:
nevsinkportal.com
  
98.100.206.210:
murph-mail.com
murph.ws
  
98.100.207.98:
sibilski.net
  
98.100.207.116:
katherinegehl.org
  
98.100.211.8:
shoppingcartregistry.com
  
98.100.211.14:
firstlookfamilylaw.com
  
98.100.211.15:
orangeshoe.com
  
98.100.211.17:
wisconsinvision.com
  
98.100.211.19:
waukeshacrane.com
  
98.100.211.22:
2000development.com
2cottages.com
3dconstructionwi.com
acculinepro.com
advancedcncsolutions.com
ahcpartners.com
aimspower.com
airportserviceinc.com
allisind.com
alphaintegratedsolutions.com
amcsi.biz
amscarpetcleaning.com
aquadoc.cc
ari-company.com
arolock.com
ati-training.com
autumglo.com
ayerforce.com
badger-underground.com
badgerlandfireplace.com
badgerunderground.com
bee-brand.com
beyondenergyllc.com
blastcraftservice.com
bluegracegospelmusic.com
brennanlandscaping.com
brookfieldofficespace.com
bryanbeckerclaywerks.com
cardinalfab.com
carnationservices.com
cedarburgcreekfarm.com
cee-corp.com
centralfileinc.com
centralmachine.com
centralwisconsinlaw.com
charliescateringcompany.com
cncmachining.org
corneron.com
countryairerides.com
couponexchangeclub.com
craftbrewerysolutionsllc.com
crittersittersinc.com
crittersitterswi.com
cyberneticinc.com
cweberbuilders.com
davidmcknightandco.com
davidmcknightandcompany.com
ddref.com
debcorpinc.com
designbuildfire.com
directdrivelogistics.us
drkochchiro.com
durhamhill.com
durhamhillnursery.com
e-meterpro.com
efficientcleaning.com
empress-products.com
enter-pro.com
epicresins-electronics.com
erinelec.com
fathersdaughterdecor.com
fbe.net
felberdesign.com
filternetworks.com
fornowater.com
gallantmfrsreps.com
galwayfarm.com
getroto.net
gmedcorp.com
graftedinbygrace.com
green-geo.net
hartfordtool.com
hdtools101.com
heartlandadhesives.com
homesbycweberbuilders.com
hotpointheating.com
hyde-env.com
hydraulicsolutionsofwiinc.com
hytorcwisconsin.com
i-coatings.com
infinitycommercialroofing.com
integratedcollegeplanning.com
integritydrainage.com
integritydrainagesolutions.com
integritypaintingpro.com
irenescatering.com
jandsautocare.com
jhintzke-cpa.com
jimkurtz.com
jobsitetough.com
johnnysquare.com
johnson-level.com
johnsonconstructionlasers.com
johnsonlasers.com
johnsonlevel.info
johnsonlevel.net
johnsonlevel.org
johnsonlevel.us
jonestools.com
jrlongtransport.com
kilpatrickengine.com
knowlesmfgco.com
knivesandbladesinc.com
landscapinginwisconsin.com
larrytheiss.com
lasers101.com
layout101.com
lemens.org
levelandsquare.com
levelpedia.com
levels101.com
levelsandsquares.com
liddoc.com
lightspeedrocks.com
lifetimeradon.com
linden-inn.com
lliarchitectural.com
loomislandscapers.com
loomislandscaping.net
ludwigconcrete.com
mahutatool.com
makeitmolly.com
mantzautomation.com
mattbrooksguitarist.com
mattresssavings.com
mccjobs.org
measure101.com
measuringwheels101.com
metromilwaukeetreeservice.com
meter-pro.com
meterpro.com
metertraining.com
mhindustrial.com
mhindustrialservice.com
milwaukee-signs.com
milwaukeelawyer.org
milwaukeelivebands.com
milwaukeeliveentertainment.com
milwaukeeroyallimo.com
milwaukeesbestwindows.com
mkeclaims.com
mkerock.com
mkesports.com
morningstarmontessori.org
mrjimk.com
mrssippyscoffee.com
mtdrecallattorney.com
mudtech.com
murfsfrozencustard.com
neriaksecurity.com
newberlinautorepair.com
newbridgewi.com
nockrefractories.com
northlanddogsupply.com
obriens-irishpub.com
obriensirish.com
oberndorferlandscape.com
ofo-inc.com
oldgloryfarmwisconsin.com
onwisconsinoutdoors.com
organichairproductreview.com
outdoorout.com
paulcolt.com
perfectionpaintingcorporation.com
performanceplus-products.com
permay.com
phcc-wi.com
pinecellarmfg.com
plantstogrow.com
plastoconinc.com
pmpworker.com
policeofficerdefense.com
propertyprepllc.com
psalab.com
psalf.com
pubclubmilwaukee.com
pubclubmke.com
qrhicorp.com
qualitycastingswi.com
reisautomotive.com
rfsbrakes.com
rgbpolymers.com
riesgraphics.com
rockcomplex.com
rockleaguebaseball.com
rodzgrooming.com
roguedogtraining.com
roughrhino.com
royallimousine.biz
rubbermulchforplayground.com
russstreeservice.com
runbloop.com
sandkpump.com
sandkpumpandplumbing.com
scslossconsultants.net
shareasmilemadison.org
sheriffclarke.com
silverkingfishon.com
simplesolutionguys.com
simplyfaster.biz
simplyfaster.info
simplyfaster.net
simplyfaster.org
simplyfaster.us
simpleearthproducts.com
siroller.com
snkpump.com
sonnenburgbuilders.com
spindleart.com
squares101.com
srsroofandmetal.com
staugwa.org
stfirewood.com
storageshedsmilwaukee.com
studsquared.com
surviveleukemia.com
symet.com
tapemeasures101.com
tempsplusjobs.net
tempsplusmedical.com
theagencyhomes.com
thecapconnection.com
themilwaukeeweddingdj.com
themulchguyswi.com
thepubclubmke.com
theumbrellabar.com
thisplacehere.com
tinasmith.com
tm-cleaning.com
townoffarmington.org
townofmanitowoc.org
trunorthcomp.com
upandrunningnow.com
uppernemahbinlake.com
usroofinginc.com
varnerengineering.com
wachteltree.com
wammghana.com
waukeshalawyer.org
waukeshaowi.com
waukesharotary.org
wedryitup.com
whatfloorisyourmarketingagenton.com
wholesomejunction.com
wifirewood.com
windycitycleaningequipment.com
wisconsinpalletracking.com
wwidr.com
  
98.100.211.24:
hvs-inc.com
  
98.100.211.26:
finitura.com
  
98.100.211.30:
mrbottles.com
  
98.100.211.31:
ayercontractors.com
badgerlandscape.com
catseyegreen.com
ddex.org
ddex.us
efficienttruckingandwarehousing.com
getbettercoffee.com
glowviewlevel.com
gotjunkremoval.com
greenbritetechnology.com
herdeman.com
hottraysystem.com
hottraysystems.com
junkremovalmadison.com
kci-engineeredservices.com
lgunlimited.com
mdcwi.com
milwaukeecoverband.com
mnawi.com
paulcoltbooks.com
paulcoltwest.com
pdcwest.com
pjsdental.com
sonnenburg.us
thejunkhaulers.com
thejunkmovers.com
wisconsinnaturaldentist.com
  
98.100.211.32:
milwaukee-jewelry.com
  
98.100.211.33:
buywormcastings.com
  
98.100.211.34:
inet-web.com
  
98.100.211.35:
palomaprintproducts.com
  
98.100.211.37:
hartlaubphce.com
  
98.100.211.38:
heidenplumbing.com
  
98.100.211.40:
enterami.com
  
98.100.211.41:
cookiesfromscratch.com
  
98.100.211.42:
aaahi.org
  
98.100.211.43:
tantyfamilydental.com
  
98.100.211.45:
rubbermulchforlandscaping.com
rubbermulchforplaygrounds.com
tristarcnc.com
  
98.100.211.46:
lakecountryhairdesignhartland.com
  
98.100.211.47:
uluro.com
  
98.100.211.48:
prairievillepark.com
  
98.100.211.50:
elementsarchitects.com
  
98.100.211.52:
surroundewe.com
  
98.100.211.53:
kokomobaseball.com
krauskollc.com
krauskosports.com
  
98.100.211.54:
ewaldfleetsolutions.com
  
98.100.211.55:
usmailsupply.com
  
98.100.211.57:
stempers.com
  
98.100.211.58:
outstandingbanners.com
  
98.100.211.59:
hdiesel.com
  
98.100.211.60:
flushandpoint.com
  
98.100.211.61:
xtremeairfun.com
  
98.100.211.62:
grievelaw.com
  
98.100.211.63:
mymartinizing.com
  
98.100.211.64:
hotlegsusa.com
  
98.100.211.65:
bgsglass.com
  
98.100.211.67:
luxtechnow.com
  
98.100.211.68:
starpackagingsupplies.com
  
98.100.211.79:
seymourseedusa.com
  
98.100.211.87:
wrightdentalcenter.com
  
98.100.211.89:
turftendersservice.com
  
98.100.211.90:
theflyfishers.com
  
98.100.211.91:
bedbugswisconsinheat.com
  
98.100.211.92:
rnow-inc.com
  
98.100.211.93:
skytrak.com
  
98.100.211.94:
brooklife.org
  
98.100.211.95:
hlfirstaid.com
  
98.100.211.96:
chiefcoinandsupply.com
  
98.100.211.97:
realityconstructionllc.com
  
98.100.211.98:
chematechnology.com
  
98.100.211.99:
trucorp.com
  
98.100.211.101:
madfoxparty.com
  
98.100.211.102:
johnsonlevel.com
  
98.100.211.103:
fescodirect.com
  
98.100.211.104:
directdrivejobs.com
  
98.100.211.105:
wabpapersupply.com
  
98.100.211.106:
brasslightgallery.com
  
98.100.211.107:
batteryproducts.com
  
98.100.211.108:
madisondumpsterrental.com
  
98.100.211.109:
greenbaydumpsterrental.com
  
98.100.211.110:
goapesonline.com
  
98.100.211.111:
kehrs.com
  
98.100.211.112:
atihomeinspectortraining.com
  
98.100.211.113:
ofwgo.com
  
98.100.211.114:
janesvilletool.com
  
98.100.211.116:
wisconsinstoneware.com
  
98.100.211.117:
aircoweld.com
weldersupply.com
weldsupply.com
  
98.100.211.118:
hannarv.com
  
98.100.211.119:
lacasadeesperanza.org
  
98.100.211.120:
americangaragebuilders.com
  
98.100.211.121:
jelmfg.com
  
98.100.211.122:
englehardtassociates.com
engelhardtassociates.com
engelhartassociates.com
  
98.100.211.123:
bikercityapparel.com
melanienickels.com
  
98.100.211.124:
bpalja.com
wilemployer.com
  
98.100.211.125:
bandmauto.com
  
98.100.211.126:
purplefootusa.com
  
98.100.211.127:
wichimney.com
wisconsinchimney.com
  
98.100.211.130:
firstklasswindowcleaning.com
  
98.100.211.132:
usmarketingcorp.com
  
98.100.211.133:
pumpsolutions1corp.com
  
98.100.211.137:
exoswi.com
  
98.100.211.138:
radexperts.com
  
98.100.211.139:
wisantique.com
  
98.100.211.140:
plastocon.com
  
98.100.211.141:
goodlandinspections.com
  
98.100.211.142:
helputhrive.com
  
98.100.211.143:
injurylawyerwi.com
  
98.100.211.145:
bernboys.com
  
98.100.211.146:
theh2oman.com
  
98.100.211.147:
directdriveexpress.com
  
98.100.211.149:
alandlords.com
foxspringbrewery.com
  
98.100.211.153:
eyecandykidsdelafield.com
  
98.100.211.154:
directdrivelogistics.com
  
98.100.211.155:
medicalsystemsusa.com
  
98.100.211.156:
johnsonlevel.es
  
98.100.211.158:
shootersonline.com
  
98.100.211.160:
exerclock.com
  
98.100.211.161:
eyecandydelafield.com
  
98.100.211.162:
northernstainless.com
  
98.100.211.163:
bonnessskincare.com
  
98.100.211.164:
americanpaper.com
  
98.100.211.165:
resinman.com
  
98.100.211.166:
tuslerlaw.com
  
98.100.211.167:
warshafsky.com
  
98.100.211.172:
metalforms.com
  
98.100.211.173:
mepwisc.org
  
98.100.211.174:
rossdentalnewberlin.com
  
98.100.211.175:
powerwashstoretn.com
  
98.100.211.176:
divergentfamilylaw.com
  
98.100.211.177:
3rdstoryguitars.com
  
98.100.211.179:
united-stoneworks.com
  
98.100.211.180:
wlem.com
  
98.100.211.181:
k2painting.com
  
98.100.211.182:
ikebitesdogtreats.com
mcdonaldlawllc.com
  
98.100.211.183:
drbonness.com
  
98.100.211.184:
mkesoccer.com
  
98.100.211.185:
warshafskylaw.com
  
98.100.211.186:
erinstutuboutique.com
junglogistics.com
  
98.100.211.187:
womenshealthcarewaukesha.com
  
98.100.211.188:
rcflightschool.com
  
98.100.211.190:
descowaterskis.com
divedesco.com
  
98.100.211.191:
tcrisk.com
  
98.100.211.193:
acelectricmotorservice.com
  
98.100.211.196:
inet-pc.com
  
98.100.211.200:
milwaukeedumpsterrental.com
  
98.100.211.201:
cblaw-wi.com
tcdmadison.com
  
98.100.211.202:
lakecountryfirewood.com
  
98.100.211.203:
mlazgar.com
  
98.100.211.204:
nutman.org
  
98.100.211.205:
cornell.com
  
98.100.211.206:
powerwashstore.com
thepowerwashstore.com
  
98.100.211.207:
usnicom.com
  
98.100.211.213:
raybaronline.com
standardmachineonline.com
  
98.100.211.214:
bonedryproducts.com
  
98.100.211.215:
wbwoolenmills.com
  
98.100.211.216:
wisconsinmaterialinstall.com
  
98.100.211.217:
eyeboutique.com
  
98.100.211.218:
brakebushtransportation.com
  
98.100.211.219:
connoils.com
wisconsincheesemarket.net
  
98.100.211.221:
clearfloplumbing.com
  
98.100.211.222:
lakecountrycustomcabinets.com
  
98.100.211.223:
ourgcc.com
  
98.100.211.224:
thebeeguy.com
  
98.100.211.227:
infinityroofing.com
  
98.100.211.228:
wisconsinsbestwindows.com
  
98.100.211.229:
roofedright.com
  
98.100.211.240:
inetwebusa.com
  
98.100.211.250:
healthyps.com
  
98.100.211.251:
gierschgroup.com
  
98.100.211.252:
dousmanfamilydentistry.com
  
98.100.212.22:
johnsonlaserlevels.com
johnsonlevel.biz
  
98.100.212.78:
360computing.com
autumnsaunders.com
  
98.100.213.116:
taindustrial.com
  
98.100.213.174:
wisux.com
  
98.100.213.214:
gpsmotors.com
  
98.100.214.68:
andyandrachel.com
  
98.100.214.74:
kbp-group.com
  
98.100.214.75:
rrgroup.com
  
98.100.214.84:
utendi.com
  
98.100.214.234:
durangotech.com
  
98.100.216.163:
chadalbrecht.net
enerlinx.com
enerlinx.net
kanbankeeper.com
kanbanmanager.com
  
98.100.218.239:
pwho-wi.com
  
98.100.219.16:
pittsburghmachine.com
pittsburghmachines.com
  
98.100.219.17:
gortonmachine.com
hvacdynamics.com
jantzautosales.com
korndoeferhomes.com
milwaukeeslide.com
spiritaliveonline.org
weg1.com
  
98.100.222.180:
rtstm4web.com
  
98.100.223.86:
gshydraulics.com
gsna.com
  
98.100.223.142:
kencook.com
  
98.100.223.148:
paccarwinchpubs.com
  
98.100.223.160:
volvotechinfo.us
  
98.100.223.164:
boatpubs.com
dpwauktechpubs.com
johndeeretechinfo.com
outboardbooks.com
vocrenewal.com
volvospecialtools.com
wgetechpubs.com
  
98.100.223.181:
maseratitechinfo.com
  
98.100.223.183:
autocarbookstore.com
  
98.100.223.185:
milwaukeesae.com
nasm.com
nasm.info
  
98.100.223.187:
volvo-surveys.com
volvosurvey.com
  
98.100.223.197:
jdtechinfo.com
  
98.100.223.205:
smartfolioapp.com
  
98.100.223.233:
media1off.com
mediaoneoff.com
  
98.100.226.163:
additivewerks.com
additivewersk.com
additivwerks.com
  
98.100.226.174:
keidl.net
tktech.com
  
98.100.228.13:
securainsurance.com
  
98.100.231.86:
tismine.com
  
98.100.232.3:
wiretech-inc.com
wiretechnologies.com
wiretechnologies.net
wtinet.net
  
98.100.233.52:
vapeonthebay.com
  
98.100.234.34:
fsig-wi.com